PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011076828.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family LBD
Protein Properties Length: 167aa    MW: 18942.4 Da    PI: 6.2302
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011076828.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601301e-4012110199
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+l+r+C+++C +apyf +++pkkfa vhk+FGasnv+k+l+++ ee+re++++slvyeAe+r++dPvyG++g i +lq+++ +l+++l 
  XP_011076828.1  12 SCAACKFLKRRCTPNCQFAPYFRSDEPKKFAKVHKVFGASNVSKILNEVAEEQREETVNSLVYEAEVRLQDPVYGCIGAIASLQHKMVELQHDLI 106
                     6*******************************************************************************************998 PP

          DUF260  96 llke 99 
                     l+++
  XP_011076828.1 107 LARA 110
                     8876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.28411112IPR004883Lateral organ boundaries, LOB
PfamPF031956.1E-4012108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MKGHQEPRSS SSCAACKFLK RRCTPNCQFA PYFRSDEPKK FAKVHKVFGA SNVSKILNEV  60
AEEQREETVN SLVYEAEVRL QDPVYGCIGA IASLQHKMVE LQHDLILARA RLACYVDQQQ  120
RHSDSFFDID HVNMAPLVDI QEPSAGVVDA FDYNALPFDQ FSPFQFP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011076828.11e-122PREDICTED: LOB domain-containing protein 21-like
SwissprotQ9SRL85e-62LBD21_ARATH; LOB domain-containing protein 21
TrEMBLA0A061FK882e-70A0A061FK88_THECC; LOB domain-containing protein, putative
STRINGVIT_13s0067g01450.t012e-67(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11090.13e-63LOB domain-containing protein 21